PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04938.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 120aa    MW: 13357 Da    PI: 9.6946
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04938.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-393393262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk+ k+s
  Rsa1.0_04938.1_g00001.1 33 QQEQLPCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKSAKRS 93
                             68999***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.0E-343591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.043791IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253991IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MMMSDSGESR QIATRSPHGV ITGLPPPTTT TEQQEQLPCP RCESTNTKFC YYNNYNFSQP  60
RHFCKSCRRY WTHGGTLRDI PVGGGTRKSA KRSRTCPSST SSSSSRDVPL QATPVLFPHS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2255861e-109AY225586.1 Brassica rapa subsp. oleifera HRa (HRa), HRb (HRb), and HRc (HRc) genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602377.13e-68PREDICTED: dof zinc finger protein DOF3.4-like
RefseqXP_013674329.12e-68PREDICTED: dof zinc finger protein DOF3.4-like
SwissprotQ9FGD62e-52DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A078FZK43e-68A0A078FZK4_BRANA; BnaC08g21910D protein
TrEMBLA0A0D3DRY33e-68A0A0D3DRY3_BRAOL; Uncharacterized protein
STRINGBra012901.1-P4e-61(Brassica rapa)
STRINGBra036082.1-P2e-61(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.18e-41OBF binding protein 1